BAZH13 BAZH13
  • 08-05-2021
  • Computers and Technology
contestada

3 alternativas donde puedas utilizar la tecnologia que nos ayude a reducir el impacto ambiental al medio ambiente

Respuesta :

IvKm
IvKm IvKm
  • 08-05-2021

Answer:

El correo, las notas y las agendas ahora están archivados en el mundo digital, ayudando a reducir la deforestación. Coches eléctricos: se está trabajando meticulosamente en reducir la contaminación que producen los vehículos, haciendo que cada vez sean más sostenibles.

Explanation:

Answer Link

Otras preguntas

Help!What is the answer to this question?​
How did Roman’s treat gladiators outside the ring?
You are a contractor and charge $65 for a site visit plus an additional $15 per hour for each hour you spend working at the site. Write and solve an equation to
Decide if the following sentence is grammatically correct or incorrect. Yo nunca fui a Mexico.
1. What can one catch that is not thrown? 2. What is always coming, but never arrives?
Complete the equation for the conversion of sucrose into glucose (1)C12H22O11 + H2O
how did early humans take control over their environment?
if the cost price of 10 chairs is equal to the selling price of 16 chairs ,find the loss or gain percentage​
25%. Of a number is 3 25% 3 50%16 1007 12
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein